World Gym Logo
World Gym Logo

Join now pay nothing!

Claim now!
World Gym AustraliaWorld Gym Australia
hero bannerchevron image

Redeem YOUR Free Pass Today!

LEARN MORE

Redeem YOUR Free Pass Today!

LEARN MORE
light-gray-chevronlight-gray-chevron

World Gym Springfield

4.4

(469 Google Reviews)

Contact Us

28 Technology Drive Augustine Heights QLD 430007 28008083Contact Us

Get Social

worldgym.springfieldwgspringfield

OPEN 24 HOURS TO MEMBERS

see staffed hours
MEMBERSHIP OPTIONS
MEMBERSHIP OPTIONS

About World Gym Springfield

Welcome to World Gym Springfield, where real people train, real results happen, and everyone belongs. Whether you're stepping into the gym for the very first time, getting back into a routine, or chasing big strength and fitness goals, you'll find everything you need right here. Our mission is simple: help you feel stronger, healthier and more confident; inside and outside the gym! We are proud to be locally owned and operated, deeply connected to our Springfield community, while also being backed by the iconic World Gym brand with over 45 years of global fitness experience. That means you get the best of...

Welcome to World Gym Springfield, where real people train, real results happen, and everyone belongs. Whether you're stepping into the gym for the very first time, getting back into a routine, or chasing big strength and fitness goals, you'll find everything you need right here. Our mission is simple: help you...

amenities at world gym Springfield

World Gym aims to give its members the very best: from modern equipment to a clean and welcoming atmosphere with an expert staff.

24/7 Access Door & Security
Functional Zone
Olympic lifting platforms & racks
Personal training & coaching
Power lifting zone
Pro shop
Strength machines
Supplements
Barbell Café
Cardio Zone
Group Fitness
Members Lounge
24/7 Access Door & Security
Functional Zone
Olympic lifting platforms & racks
Personal training & coaching
Power lifting zone
Pro shop

explore more at world gym Springfield

We’re confident that we are the best gym near you, and we invite you to experience it for yourself.

Creche Program
World Gym

Learn More About our Memberships

To find out more about our membership options please complete the form below.

We love our community

4.4

469 Google Reviews
Testimonials background image

5/5

Google Review

Anastasia Navin

I think everyone assumes a gym is a gym, go to the one closest to you or the one thats cheapest but i think thats further from the truth. The previous gym i went to was packed at 6pm on a weekday and most assume thats just how it is but world gym is different, I dont know if its because they are just bigger but I can go to the gym and do every I want to. It can be packed but your never waiting for a machine. The staff are amazing, they offer protein shakes and snacks while open, fridge for any food you might take with you. Locker space, bathroom and showers are clean and well maintained. All the equipment is looked after and feels good to train with. They have every machine you can think of and multiple different types for each muscles. There isnt much floor space for workouts if thats what your into and I can't comment on classes or PTS as I haven't used them. I feel like world gym mainly forced on weight lifting but it dose cater for everyone. As well the people there are respectful and considerate and will always save you if your dying.

Testimonials background image

5/5

Google Review

Anastasia Navin

I think everyone assumes a gym is a gym, go to the one closest to you or the one thats cheapest but i think thats further from the truth. The previous gym i went to was packed at 6pm on a weekday and most assume thats just how it is but...

5/5

Google Review

Corey Lindh

⭐⭐⭐⭐⭐ Absolute 5-Star Gyms! I’ve been a member of World Gym since starting at the Ipswich location, and I was immediately blown away. Right off the bat, the staff were super friendly, the environment was welcoming, and they had the latest, newest range of machines. On top of that, their cafe and team are incredible! When they opened the Springfield location, I decided to switch over since it was closer, and wow—this place truly has it all. It’s exceptionally clean, the gear and equipment are top-tier, and the staff are always smiling and happy to lend a hand. Plus, you can't beat their cafe—they make the best post-workout shakes around, and the membership prices are unbelievably reasonable compared to all the other gyms I’ve tried in the past. If you're looking for a gym with great vibes, top-notch equipment, awesome staff, and real value for money, World Gym Ipswich and Springfield are unbeatable. Highly recommend!

Testimonials background image

5/5

Google Review

Corey Lindh

⭐⭐⭐⭐⭐ Absolute 5-Star Gyms! I’ve been a member of World Gym since starting at the Ipswich location, and I was immediately blown away. Right off the bat, the staff were super friendly, the environment was welcoming, and they had the latest, newest range of machines. On top of that, their cafe...

4/5

Google Review

Nathan Wilkinson

Staff = wonderful Equipment = fantastic Price = great TV entertainment = repeats of Pawn Stars, or nothing at all Music = Either Drake or gangster rap on repeat

Testimonials background image

4/5

Google Review

Nathan Wilkinson

Staff = wonderful Equipment = fantastic Price = great TV entertainment = repeats of Pawn Stars, or nothing at all Music = Either Drake or gangster rap on repeat

5/5

Google Review

Roy Taliulu

Best place ever ,gears & all machines are good

Testimonials background image

5/5

Google Review

Roy Taliulu

Best place ever ,gears & all machines are good

5/5

Google Review

Charli Hay

Yesterday i walked into the gym and MY GOODNESS. Amber the kind young girl was so kind to me. She was so helpful with letting me book my child in to creche. Please give her a raise i want to see her succeed. Good work Amber.

Testimonials background image

5/5

Google Review

Charli Hay

Yesterday i walked into the gym and MY GOODNESS. Amber the kind young girl was so kind to me. She was so helpful with letting me book my child in to creche. Please give her a raise i want to see her succeed. Good work Amber.

5/5

Google Review

Anastasia Navin

I think everyone assumes a gym is a gym, go to the one closest to you or the one thats cheapest but i think thats further from the truth. The previous gym i went to was packed at 6pm on a weekday and most assume thats just how it is but world gym is different, I dont know if its because they are just bigger but I can go to the gym and do every I want to. It can be packed but your never waiting for a machine. The staff are amazing, they offer protein shakes and snacks while open, fridge for any food you might take with you. Locker space, bathroom and showers are clean and well maintained. All the equipment is looked after and feels good to train with. They have every machine you can think of and multiple different types for each muscles. There isnt much floor space for workouts if thats what your into and I can't comment on classes or PTS as I haven't used them. I feel like world gym mainly forced on weight lifting but it dose cater for everyone. As well the people there are respectful and considerate and will always save you if your dying.

Testimonials background image

5/5

Google Review

Anastasia Navin

I think everyone assumes a gym is a gym, go to the one closest to you or the one thats cheapest but i think thats further from the truth. The previous gym i went to was packed at 6pm on a weekday and most assume thats just how it is but...

5/5

Google Review

Corey Lindh

⭐⭐⭐⭐⭐ Absolute 5-Star Gyms! I’ve been a member of World Gym since starting at the Ipswich location, and I was immediately blown away. Right off the bat, the staff were super friendly, the environment was welcoming, and they had the latest, newest range of machines. On top of that, their cafe and team are incredible! When they opened the Springfield location, I decided to switch over since it was closer, and wow—this place truly has it all. It’s exceptionally clean, the gear and equipment are top-tier, and the staff are always smiling and happy to lend a hand. Plus, you can't beat their cafe—they make the best post-workout shakes around, and the membership prices are unbelievably reasonable compared to all the other gyms I’ve tried in the past. If you're looking for a gym with great vibes, top-notch equipment, awesome staff, and real value for money, World Gym Ipswich and Springfield are unbeatable. Highly recommend!

Testimonials background image

5/5

Google Review

Corey Lindh

⭐⭐⭐⭐⭐ Absolute 5-Star Gyms! I’ve been a member of World Gym since starting at the Ipswich location, and I was immediately blown away. Right off the bat, the staff were super friendly, the environment was welcoming, and they had the latest, newest range of machines. On top of that, their cafe...

world gym Springfield faqs

follow world gym Springfield on socials

WORLD GYM

SUPPORT

COMPANY

World Gym International

  • Change country
World Gym Logo

© 2024 All Rights Reserved.
Every World Gym is independently owned and operated.